General Information

  • ID:  hor006595
  • Uniprot ID:  Q91826
  • Protein name:  Potential
  • Gene name:  pgla-b
  • Organism:  Xenopus laevis (African clawed frog)
  • Family:  Gastrin/cholecystokinin family, Magainin subfamily
  • Source:  animal
  • Expression:  Expressed by the skin glands. Synthesized in the stomach and stored in a novel granular multinucleated cell in the gastric mucosa. Stored as active, processed peptides in large granules within the granular gland secretions of the skin.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Xenopus (subgenus), Xenopus (genus), Xenopodinae (subfamily), Pipidae (family), Pipoidea (superfamily), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0006952 defense response; GO:0031640 killing of cells of another organism; GO:0042742 defense response to bacterium; GO:0050832 defense response to fungus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  EASALADADDDDDKRYVRGMASKAGAIAGKIAKVALKALGRRDS
  • Length:  44
  • Propeptide:  MYKQIFLCLIIAALCATIMAEASALADADDDDDKRYVRGMASKAGAIAGKIAKVALKALGRRDS
  • Signal peptide:  MYKQIFLCLIIAALCATIMA
  • Modification:  T39 Leucine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  PGLa and PGLa-H display a broad-spectrum of antibacterial activity against a range of Gram-positive and Gram-negative bacteria. PGLa also displays antifungal activity against C.albicans ATCC 14053. PGLa-H shows moderate antibacterial activity against the multidrug-resistant methicillin-resistant S.aureus (MRSA) but exhibits very little hemolytic activity.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q91826-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006595_AF2.pdbhor006595_ESM.pdb

Physical Information

Mass: 531534 Formula: C191H325N61O65S
Absent amino acids: CFHNPQTW Common amino acids: A
pI: 9.16 Basic residues: 9
Polar residues: 8 Hydrophobic residues: 18
Hydrophobicity: -46.14 Boman Index: -10692
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 82.5
Instability Index: 1830.23 Extinction Coefficient cystines: 1490
Absorbance 280nm: 34.65

Literature

  • PubMed ID:  6688991
  • Title:  A novel peptide designated PYLa and its precursor as predicted from cloned mRNA of Xenopus laevis skin.
  • PubMed ID:  3606567
  • Title:  Biosynthesis and degradation of peptides derived from Xenopus laevis prohormones.
  • PubMed ID:  1717472
  • Title:  Antimicrobial peptides in the stomach of Xenopus laevis.
  • PubMed ID:  22014884
  • Title:  Isolation and characterisation of a new antimicrobial peptide from the skin of Xenopus laevis.